PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10027771m
Common NameEUTSA_v10027771mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 444aa    MW: 49582.7 Da    PI: 4.5389
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10027771mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57395.94e-3052146397
           DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      ++ +w+e+ e+++L+Gl+d++ +t  +p  d+d+f++f+k+si+++v+k+ql++Kir+LK++f  +++++ +g++p f++  d+++f+++k+iW
  Thhalv10027771m  52 MKEIWNEDNELAVLKGLVDYRVRTMHEPGFDWDGFFDFIKGSIKAEVTKEQLLSKIRKLKRRFVVHMERITQGNDPLFTRFTDSQAFGYAKMIW 145
                      689******************************************************************************************* PP

           DUF573  97 g 97 
                      +
  Thhalv10027771m 146 D 146
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.4E-2353146IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MVTPKRLNFS SSACGDSDTR LEKLPSTHAA EEQEPMKTKT TKKKKKKQKS MMKEIWNEDN  60
ELAVLKGLVD YRVRTMHEPG FDWDGFFDFI KGSIKAEVTK EQLLSKIRKL KRRFVVHMER  120
ITQGNDPLFT RFTDSQAFGY AKMIWDSAED EVDNRSSIRE KALQNENGEN AFKENEQVNN  180
DEPVNKNGKV PPEVVCMEEA EQTENGEGAF KECDQVDKDA PLNENGKSIL EVVGMENAQQ  240
TEGDNAFKEN EQAANGEPVN INGTSVPEAV GMENAQQTEN GECSVKENGQ VGNAEHVNEN  300
GKSLPEAQQV ENGECAFKEN GQASNDEPVN ENEAEKSNSD GKSLPEAVGV DKTAEHKTDG  360
NENHDNEDDA DDLCSVQDAF ETMMWKGLTD YQKKLQIEKL KNIRTGKRKE LSSEWKALCA  420
EELNLNIKKL RLCANLAEAA NHA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405985.10.0hypothetical protein EUTSA_v10027771mg
TrEMBLV4M5650.0V4M565_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.13e-73DNA-binding storekeeper protein-related transcriptional regulator